PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29820.m001029
Common NameRCOM_0849600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 558aa    MW: 61085 Da    PI: 7.2021
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29820.m001029genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.72.4e-33237294260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  29820.m001029 237 DDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSL-DGQITEIVYKGSHNHPK 294
                    8****************************************.***************85 PP

2WRKY105.52.7e-33396454159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Cts gCpv+k+ver+++d+++v++tYeg+Hnh+
  29820.m001029 396 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSIGCPVRKHVERASHDTRAVITTYEGKHNHD 454
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-28229295IPR003657WRKY domain
SuperFamilySSF1182909.15E-26230295IPR003657WRKY domain
PROSITE profilePS5081123.904231295IPR003657WRKY domain
SMARTSM007741.3E-36236294IPR003657WRKY domain
PfamPF031061.2E-25237293IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.2E-37381456IPR003657WRKY domain
SuperFamilySSF1182902.62E-29388456IPR003657WRKY domain
PROSITE profilePS5081138.744391456IPR003657WRKY domain
SMARTSM007746.5E-39396455IPR003657WRKY domain
PfamPF031061.5E-25397454IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MASFTTSSSS SSSCSLNTSI NSQSSFFSTQ FLMTNPSSSS LSSFTDLLSS GNINSKDNNM  60
DNINVGWGLF DHGNGIDIPK FKSFPPPSLP LSPPPVSPSS YFAIPPAGLS PTDFLDSPVL  120
FSTSNVVPSP TTGTFAGQTF NWRSNISNDN QRGFKGDEKT YSDFSFQTQT RPLLASSSSP  180
SEKGVVKQEF TPVQSFSSEM APLQSSMQTN AVAPQPQPSY NHYSQPASYM REQRRSDDGY  240
NWRKYGQKQV KGSENPRSYY KCTYPNCPTK KKVERSLDGQ ITEIVYKGSH NHPKPQARSS  300
SQLIQLAAGG TQEISDQSFA PVESVTMQED SSLSIGDDEF DQSSPISNSG GNEDENEPEA  360
KRFKGQNENE SILAAGSRTV REPRIVVQTT SDIDILDDGY RWRKYGQKVV KGNPNPRSYY  420
KCTSIGCPVR KHVERASHDT RAVITTYEGK HNHDVPAARG SGYASNRLPV NANSSMPIPI  480
RPSVTANTNY SNSLNSTRSS GNQAPFTLQM LQGTGNIGFS NFGKPSASYM NQTQYTENVF  540
SGAKEEPKDD SFLDSFLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-34237457878Probable WRKY transcription factor 4
2lex_A9e-34237457878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015579371.10.0PREDICTED: probable WRKY transcription factor 33
SwissprotQ8S8P51e-140WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLB9SL310.0B9SL31_RICCO; Transcription factor, putative
STRINGPOPTR_0016s13600.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-136WRKY DNA-binding protein 33